Get custom programming done at ScriptLance.com!

Saturday, February 18, 2006

the end...

the end of breadfairytales...

Sunday, December 18, 2005

existence...

well... i quit on the first day of working... getting lazy and lazy to blog... hopping to become self-employed. my dream since young. experience experience experience is the most important thing. well, dunno how far i can do.. dunno how far i can go.. no matter wat, i won't give up.

watched a movie name, 'the truman show'. is a movie talking about existance of a human. destiny and fate. is everything well-planned by god? well, talk back about jessie chung, one of my fren was saying.. god sometimes is unfair, how could he created people with such 'weird' thing to happen.

well, for me.. god is fair to everyone. is jz how we see things. jz like me, jobless... who to blame? myself of course. on the another hand, i have something to try out. end up, there's nobody to blame of.

how about truman? since he was born, his started his life in a damn freaking huge with hi tech unusual effect studio without his own aknowledgement. however, his life jz keep on continue. day after day, doin the same routine, having wife, parents, friends, neighbour, collegue. he is jz like normal human. he is jz like normal human being, having goal and dream on his own. his dream is goin to fiji and leave the island where he is staying now. till the day he found out that his daily life is recorded, his doubt is existence. who are you as the director to lead my life? who are you to play the role of god to bring disaster for me? thing gone worse when looking it widely. is my 'wife' really love me? is my parents is my real parents? if only everything is fake, i'm jz actor in your movie and robot as ur employee. who am i? am i really exist? whoever i am, the most important is who will recognize my existance? i must get out of the studio to find my own existance. i know there is more thing i can do. not only being guided and fated by a plot of a director.

yes, it's true, god playing his role as our director. however, if a person keep on believe, my life is destined, my life is fated, jz sit down n do nothing, food will fall in front of you. i do believe in destiny. i even believe it could be changed. sometimes thing wun jz go the way u always wan. it's jz a small n normal test by god of how sincere u wan to get your thing. if only you never give up in having it, u will always have it. god is fair, giving you one thing and taking one thing from you. however, is normal, as human never see their own advantange.

no matter wat, the most important is, who are you to yourself, who are you to your wife, who are you to your parents, who are you to your friend. everyday we are meeting up with different ppl, not all we are talking too. however, meeting at least once, is your chance to showing your existance. that's a fate between you and every stranger you met. some playing fool around to let ppl recognize their existance. till the end, they realised, to acknowledge own existance, the most important thing is the success u get.

know a lot people is not so great, the great part of life is when a lot of people knowing who are you. this is when everyone acknowledge your existence. and recognize your existence. cheer up friend. go for your goal. one day, ur existence will be ackowledged.

Tuesday, December 06, 2005

at last...

after so long on vacation.. at last i found a job nearby my house. data entry job... n a lot of interview request send from different company.... however, it's too far and traffic, so i opted, data entry. haha... it's an advertising company. i guess, well.. i'm currently working for one advertising website too. might launch soon. very soon...

so.. on my vacation, the first place i went was.. gua tempurung.. too bad no pic to upload this time.. it's a cave full of adventure... climbing up n down.. crawling inside water... watching the rock above head... damn.. nice place to burn fat...

not much place to go on this vacation.. broke.. so nothing much to write.. previously lazy to write.. actually a lot of story to tell.. but forgot.. haih.. will spend some time on my blog..

well, this is a new story... gal-gal and boy-boy relationship. newspaper bloom with jessie chung story. wat big deal? do u agree with same gender relationship? of course, as fren, close fren, gud fren.. that's nothing.. as lifetime partner? well depends. they in love to who they love.. not becoz who they are. as a guy, ask ourselves... y find pretty gal as gf? nice to sleep on bed, right? sometimes i do think.. same gender relationship bring one thing gud.. they understand their partner well, becoz they are same. same feeling, same mood, same thinking, even same lifestyles. it's jz the human perception on them about their lifestyles. perception number 1... AIDS. different gender having sex oso got aids ler. haih...

this type of person, they tend to hide themselves from community. y? nobody understand them. anyway, do remember one thing? they are coming out from the same place as we all do, whom is called, mother. they oso need love. some are being cheated by guys and end up.. being les... wether gay or les, hormon sometimes playing it roles. dun one straight point out, it's becoz of influence. that's not always true.

yo yo.. too much talking.. gonna sleep.. gud nite

Sunday, November 13, 2005

phoenix...

nah... michelle... heavenly bird ar... phoenix ar... taken from thestar.com.my ar... now u trust me?

Monday, October 31, 2005

happy halloween....

Friday, October 28, 2005

sooooo looooooooong.........




Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch [58 characters]
The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave
This Welsh town on the island of Anglesey is only known due to the fact that it has a very long name, and is the longest railway station name in Britain, and probably the longest domain name in the world.

The name translates as 'St Mary's church in the hollow of the white hazel near a rapid whirlpool and the church of St Tysilio of the red cave'.

Originally called Llanfair Pwllgwyngyll, which means 'The Mary church by the pool near the white hazels' the village was renamed in the 19th Century.
This was around the time when the railway was built between Chester and Holyhead at the beginning of the 1850s. A local committee was put together to try and encourage trains, travellers and 19th Century tourists to stop at the village in order to help develop the village as a commercial and tourist centre. It is believed that the name Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch was invented by a cobbler from Menai Bridge; little did he know that he had implemented one of the most successful tourist marketing plans of all time. Today the village is signposted as Llanfairpwllgwyngyll and is known to locals as Llanfairpwll or Llanfair.
Extracted from http://www.bbc.co.uk/dna/h2g2/A403642



Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraet
hceredigion
[67 characters]
Mawddach Station with its dragon's teeth on the northerly Penrhyn Drive on the golden beach of Cardigan Bay
The railway was originally built in 1895 as a horse drawn tramway used in the construction of Fairbourne village. It was built by Arthur McDougall of McDougall's flour to 2ft. gauge. In 1916 it was converted into a 15” steam tourist railway, and ran successfully until the railway was eventually sold to the controversial John Ellerton and family who converted it to the present 12¼" gauge. He made many Improvements and brought new locomotives to Fairbourne. The old “golf halt” was renamed GORSAFAWDDACHAIDRAIGODANHEDDOGLEDDOLLONPENRHY
NAREURDRAETHCEREDIGION as an attempt to get into the Guinness Book of Records by making it the station with the longest name. The railway became known as The Fairbourne and Barmouth Steam Railway and was sold to its present owners in 1995
Extracted from http://www.minitrains.20m.com/pages/fairreport.html


Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihi
maungahoronukupokaiwhenuaakitanarahu
[92 characters]
The brow of the hill where Tamatea, with the bony knees, who slid and climbed mountains, the great traveller, sat and played on the flute to his beloved
Porangahau (in New Zealand's South Island) is a unique coastal experience and is famous for it's seafood. Located just and just 44 kms from Waipukurau, it also boasts the longest place name in the world
Extracted from http://www.bbc.co.uk/dna/h2g2/A418565


Krungthepmahanakornamornratanakosinmahintarayutthayamaha
dilokphopnopparatrajathaniburiromudomrajaniwesmahasathar
namornphimarnavatarnsathitsakkattiyavisanukamprasit
[163 characters]
City of Angels
Theppitak Karoonboonyanan, a Bangkok wordsmith, who said the correct spelling (163 letters) is:

Krung­thep­maha­nakorn­amorn­ratana­kosin­mahintar­ayutthay­amaha­dilok­phop­noppa­ratrajathani­burirom­udom­rajaniwes­mahasat­harn­amorn­phimarn­avatarn­sathit­sakkattiya­visanukamprasit.

Theppitak separated the words of K161t and translated them as:

krungthep mahanakorn
The great city of angels,

amorn rattanakosin mahintara yutthaya mahadilok phop
the supreme unconqueralble land of the great immortal divinity (Indra),

noparat rajathani burirom
the royal capital of nine noble gems, the pleasant city,

udomrajaniwes mahasatharn
with plenty of grand royal palaces,

amorn phimarn avatarnsathit
and divine paradises for the reincarnated deity (Vishnu),

sakkatattiya visanukam prasit
given by Indra and created by the god of crafting (Visnukarma).

Theppitak said. "King Rama 1, the founder of the city himself, was named yet longer than the name of the city, in his ascending to the throne. Our King Rama 9 (King Bhumipol) also has a long name of a hundred letters.

"The name of the city was given by King Rama 1, the founder of the city, to celebrate the new capital, 219 years ago, after Sukhothai, Ayudhaya, and Thonburi.

"The name Bangkok is still used in international context because it was more familiar to foreigners in the past. In Thai, the city is called Krungthep in short, and is written with an abbreviation sign after it.

"It may be pronounced as Krungthepmahanakorn in some formal occasions. But when we refer to the full name, it's the one with hundreds of letters as mentioned. If you want to get some formal evidence of the name, you may have to ask some governmental offices, or the Royal Palace.
Extracted from http://www.answerbag.com/a_view.php/6267


not even know how to pronounce it...

Wednesday, October 26, 2005

i'm back...

after so long holiday (not really long actually.. jz feel it's long) me now back to intelligent city. well, jz feel wanna get closer to my dear... life in hometown make me feel the time is so hard to pass by... rotten me softly...

in my previous holiday (now still holiday actually)... my gf went back to my hometown together with me... very well, since i stay in the smallest state in this country... i got no place better to show her except gua kelam (cave of darkness)... end up i told her... visiting gua kelam is same as visit the whole perlis... haha... after she went back.. my mum told me where i could bring her go... should tell me earlier... anyway, it's gud too... next time can find excuse to ask my gf come my house again... haha... the best thing for her in my house is being my maid... unpaid one..

anyway... it's lucky enuf for her to come my place in the ninth-month in lunar calendar. watching parade at night is the best thing to do in the ninth-day of ninth-month in lunar calendar. n bring her go temple every night just to see... erm... i oso dunno wat to see.. anyway, there are 2 pics attracted me... oo.. share share here...



anything special inside the pic? if couldn't see anything.. enlarge it...

since perlis is small enough to gimme a question where to bring her go, i bring her go changloon instead... neighbour town in neighbour state... it's mini zoo i could name it... small small zoo make me feel excited after seeing some magical world of animal... things that never able to see in town...



have you ever seen horse dick? have you ever seen parrot french kiss? have you ever seen a bear tongue? have you ever seen monkey nipples? hahahahaha.... btw, do you know that owl can turn their head 360 degrees? i hope i could too...


ooo... heavenly bird... no english version here... the bird always stay at the top... unavailable to capture the real bird...

great, that's all my gf vacation story in perlis. on the very last day, she took flight back to klia. i being scold by the policeman for bypassing the border.. hell yeah, i wonder will they scold tourist too. very well, i adapted with the rude policeman and guard everywhere in my place. probably this is how their voice... unable to control the volume...

so on the way back to my home after sending my gf to airport, the radio was talking about lame excuse... these are few lame excuses told by the caller:
1) the caller bf didn't appear for the date.. probably forgot or wat.. well the excuse given by her bf is... sorry i was robbed on the day i get my salary, so i didn't turn up to meet you. => hahahaha.... guess wat the dj said... told your bf that you are not staying US.
2) after break up... the bf wanted to take back a golden bracelet from his ex... so this is the excuse he made up... erm.. could u plz lend me the bracelet that i gave u? my fren would like to cope the exactly the same bracelet for his gf... end up.. there is no return... => so cheapskate... hahahaha..
3) this is the common one... eh.. could u plz pay for my bill first? my wallet is in the car... => maybe one or twice should be ok... but if too often... use other excuse ler... hahaha...

that's all my vacation with my gf... now is job hunting time for myself.. being broke... hopefully luck will be on my head... jya..